|
HS Code |
703091 |
| Product Name | Thymosin β4 Acetate |
| Chemical Formula | C212H350N56O78S |
| Molecular Weight | 4963.49 g/mol |
| Purity | ≥98% (HPLC) |
| Appearance | White lyophilized powder |
| Storage Temperature | -20°C |
| Solubility | Water soluble |
| Cas Number | 77591-33-4 |
| Peptide Sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Source | Synthetic |
As an accredited Thymosin Β4 Acetate factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.
| Packing | Thymosin β4 Acetate is packaged in a sterile, sealed 10mg vial, labeled clearly with product details, lot number, and expiry date. |
| Shipping | Thymosin β4 Acetate is shipped in tightly sealed, inert containers under cool, dry conditions to maintain stability and prevent degradation. Shipping is generally via express courier with temperature control, often packed with ice packs or dry ice. All regulations for handling, labeling, and transporting hazardous chemicals are strictly followed. |
| Storage | Thymosin β4 Acetate should be stored in a tightly sealed container, protected from light and moisture. For long-term storage, keep it at -20°C or lower. Avoid repeated freeze-thaw cycles. The powder form is stable when stored dry, and reconstituted solutions should be kept at 2–8°C and used within a short period to maintain stability and potency. |
Competitive Thymosin Β4 Acetate prices that fit your budget—flexible terms and customized quotes for every order.
For samples, pricing, or more information, please contact us at +8615365186327 or mail to sales3@ascent-chem.com.
We will respond to you as soon as possible.
Tel: +8615365186327
Email: sales3@ascent-chem.com
Flexible payment, competitive price, premium service - Inquire now!