Products

Thymosin Β4 Acetate

    • Product Name: Thymosin Β4 Acetate
    • Alias: TB-500
    • Einecs: 1314-896-0
    • Mininmum Order: 1 g
    • Factroy Site: Yudu County, Ganzhou, Jiangxi, China
    • Price Inquiry: sales3@ascent-chem.com
    • Manufacturer: Ascent Petrochem Holdings Co., Limited
    • CONTACT NOW
    Specifications

    HS Code

    703091

    Product Name Thymosin β4 Acetate
    Chemical Formula C212H350N56O78S
    Molecular Weight 4963.49 g/mol
    Purity ≥98% (HPLC)
    Appearance White lyophilized powder
    Storage Temperature -20°C
    Solubility Water soluble
    Cas Number 77591-33-4
    Peptide Sequence SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
    Source Synthetic

    As an accredited Thymosin Β4 Acetate factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.

    Packing & Storage
    Packing Thymosin β4 Acetate is packaged in a sterile, sealed 10mg vial, labeled clearly with product details, lot number, and expiry date.
    Shipping Thymosin β4 Acetate is shipped in tightly sealed, inert containers under cool, dry conditions to maintain stability and prevent degradation. Shipping is generally via express courier with temperature control, often packed with ice packs or dry ice. All regulations for handling, labeling, and transporting hazardous chemicals are strictly followed.
    Storage Thymosin β4 Acetate should be stored in a tightly sealed container, protected from light and moisture. For long-term storage, keep it at -20°C or lower. Avoid repeated freeze-thaw cycles. The powder form is stable when stored dry, and reconstituted solutions should be kept at 2–8°C and used within a short period to maintain stability and potency.
    Free Quote

    Competitive Thymosin Β4 Acetate prices that fit your budget—flexible terms and customized quotes for every order.

    For samples, pricing, or more information, please contact us at +8615365186327 or mail to sales3@ascent-chem.com.

    We will respond to you as soon as possible.

    Tel: +8615365186327

    Email: sales3@ascent-chem.com

    Get Free Quote of Ascent Petrochem Holdings Co., Limited

    Flexible payment, competitive price, premium service - Inquire now!

    Certification & Compliance
    Top