Products

Pancreatic Polypeptides

    • Product Name: Pancreatic Polypeptides
    • Alias: PP
    • Einecs: 257-411-0
    • Mininmum Order: 1 g
    • Factroy Site: Yudu County, Ganzhou, Jiangxi, China
    • Price Inquiry: sales3@ascent-chem.com
    • Manufacturer: Ascent Petrochem Holdings Co., Limited
    • CONTACT NOW
    Specifications

    HS Code

    324622

    Product Name Pancreatic Polypeptides
    Molecular Formula C136H220N42O41
    Molecular Weight 4200 Da
    Source Human pancreas
    Appearance White to off-white powder
    Solubility Soluble in water
    Storage Temperature -20°C
    Purity ≥95% (HPLC)
    Cas Number 58069-89-1
    Sequence APLEPVYPGDNATPEQMAQYAAELRRYINMLTRPRY

    As an accredited Pancreatic Polypeptides factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.

    Packing & Storage
    Packing White, opaque plastic vial containing 10 mg Pancreatic Polypeptides, sealed with a tamper-evident cap and labeled with product details.
    Shipping Pancreatic Polypeptides are shipped in temperature-controlled packaging, typically on dry ice, to maintain stability and preserve bioactivity. The shipment complies with IATA regulations for biological substances, ensuring safe and secure delivery. Documentation, such as SDS and CoA, accompanies all orders to support proper handling and regulatory compliance upon receipt.
    Storage Pancreatic Polypeptides should be stored at -20°C or lower, protected from light and moisture. Store in a tightly sealed container to prevent degradation or contamination. Avoid repeated freeze-thaw cycles. Before use, allow the vial to reach room temperature gradually. If supplied in lyophilized form, reconstitute only before use and store aliquots as recommended by the manufacturer.
    Free Quote

    Competitive Pancreatic Polypeptides prices that fit your budget—flexible terms and customized quotes for every order.

    For samples, pricing, or more information, please contact us at +8615365186327 or mail to sales3@ascent-chem.com.

    We will respond to you as soon as possible.

    Tel: +8615365186327

    Email: sales3@ascent-chem.com

    Get Free Quote of Ascent Petrochem Holdings Co., Limited

    Flexible payment, competitive price, premium service - Inquire now!

    Certification & Compliance
    Top