|
HS Code |
284341 |
| Name | Galanins |
| Type | Neuropeptide |
| Molecular Formula | C77H124N22O21 |
| Sequence | GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS |
| Molecular Weight | 3146 Da |
| Biological Source | Animal tissue (primarily nervous system) |
| Solubility | Water soluble |
| Storage Temperature | -20°C |
| Purity | Typically >95% |
| Appearance | White to off-white powder |
| Application | Research (neuroscience, endocrinology) |
| Cas Number | 86566-75-6 |
As an accredited Galanins factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.
| Packing | Galanins are supplied in a 1 mg amber glass vial with tamper-evident seal, labeled with product details, storage conditions, and CAS number. |
| Shipping | Galanins are shipped as lyophilized powder or solution, securely packaged in insulated containers with cooling packs to maintain stability during transit. Shipping is typically conducted via express courier, adhering to regulatory guidelines for biochemical substances, with appropriate documentation provided for safe and compliant delivery. |
| Storage | Galanins are stored in large dense-core vesicles within neurons, particularly in the central and peripheral nervous systems. These neuropeptides are found in nerve terminals and are co-localized with other neurotransmitters. Upon stimulation, galanins are released from these vesicles into the synaptic cleft, where they modulate various physiological functions, including pain processing, mood, and neuroendocrine signaling. |
Competitive Galanins prices that fit your budget—flexible terms and customized quotes for every order.
For samples, pricing, or more information, please contact us at +8615365186327 or mail to sales3@ascent-chem.com.
We will respond to you as soon as possible.
Tel: +8615365186327
Email: sales3@ascent-chem.com
Flexible payment, competitive price, premium service - Inquire now!