Exendins

    • Product Name: Exendins
    • Alias: GLP-1 receptor agonists
    • Mininmum Order: 1 g
    • Factroy Site: Yudu County, Ganzhou, Jiangxi, China
    • Price Inquiry: admin@ascent-chem.com
    • Manufacturer: Ascent Petrochem Holdings Co., Limited
    • CONTACT NOW
    Specifications
    HS Code 544836
    Product Name Exendins
    Category Peptide
    Main Usage Diabetes treatment research
    Origin Lizard venom
    Molecular Formula C184H282N50O60S
    Molecular Weight 4186.6 g/mol
    Mechanism Of Action GLP-1 receptor agonist
    Storage Temperature -20°C
    Solubility Water soluble
    Purity ≥95% (HPLC)
    Form Lyophilized powder
    Cas Number 141758-74-9
    Sequence HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

    As an accredited Exendins factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.

    Packing & Storage
    Packing Exendins are packaged in sterile, amber glass vials containing 1 mg lyophilized powder, labeled with batch number and storage instructions.
    Shipping Exendins are shipped in secure, temperature-controlled packaging—typically on dry ice—to maintain stability and prevent degradation. Each shipment includes safety documentation and complies with all regulatory guidelines for handling bioactive peptides. Delivery is prompt and traceable, ensuring the product’s integrity upon arrival for research or laboratory use.
    Storage Exendins should be stored at -20°C, protected from light and moisture. Solutions are best prepared in sterile, distilled water or buffer, filtered, and aliquoted to avoid repeated freeze-thaw cycles. Reconstituted solutions should be used promptly or stored at -80°C for long-term use. Proper labeling and handling are essential to maintain peptide stability and bioactivity.
    Application of Exendins
    Purity 98%: Exendins with purity 98% is used in diabetes research studies, where enhanced receptor binding and accurate pharmacological profiling are achieved.Stability temperature 4°C: Exendins with stability at 4°C is used in clinical sample storage, where prolonged activity and reliable shelf-life are ensured.Molecular weight 4.2 kDa: Exendins with a molecular weight of 4.2 kDa is used in in vivo metabolic studies, where optimal tissue penetration and rapid systemic distribution are observed.Formulation lyophilized powder: Exendins in lyophilized powder formulation is used in protein-based drug formulation, where ease of reconstitution and consistent dosing are obtained.Solubility in PBS: Exendins with solubility in PBS is used in cell-based GLP-1 receptor assays, where homogeneous mixing and reproducible experimental results are provided.Bioactivity >90%: Exendins with bioactivity greater than 90% is used in therapeutic peptide development, where maximal efficacy and robust biological response are demonstrated.Endotoxin level <0.01 EU/μg: Exendins with endotoxin level below 0.01 EU/μg is used in preclinical animal models, where immune response interference is minimized.Peptide sequence homology >98%: Exendins with peptide sequence homology over 98% is used in structural biology studies, where reliable modeling of analog interactions is facilitated.
    Free Quote

    Competitive Exendins prices that fit your budget—flexible terms and customized quotes for every order.

    For samples, pricing, or more information, please contact us at +8615365186327 or mail to admin@ascent-chem.com.

    We will respond to you as soon as possible.

    Tel: +8615365186327

    Email: admin@ascent-chem.com

    Inquiry

    Get Free Quote of Ascent Petrochem Holdings Co., Limited

    Flexible payment, competitive price, premium service - Inquire now!

    Certification & Compliance
    More Introduction

    Introducing Exendins: Experience the Difference with a True Manufacturer

    Exendins: Our Commitment, Our Innovation

    In our years of advancing peptide production, we have learned that the value in each molecule lies beyond simple purity or yield. Exendins have emerged from our laboratories through careful, deliberate innovation rather than quick fixes or generic catalog offerings. Each batch reflects not just a manufacturing process but a commitment to the science and to our customers who demand genuine solutions, not just another reagent with a label.

    Built from the Ground Up: How Exendins Begin

    Authenticity starts at the source. We control every aspect of Exendins synthesis, from amino acid selection to final purification. Rigorous analysis confirms each batch’s identity and consistency. We favor well-validated routes, not shortcuts, so researchers and developers can rely on the biological activity reported—and observed—in each sample. That reliability stands in contrast to patched-together supply chains or relabeled peptides that sometimes fail well before they reach the experimental bench.

    Difference Is in Every Model and Specification

    Many companies offer peptides under the same name, but subtle differences matter. Exendins are manufactured with clear attention to detail, including chain length, folding, and established variants. Each lot’s authenticity is confirmed against multiple benchmarks: mass spectrometry profiles, purity based on area normalization, and direct bioactivity against reference standards known to behave consistently in physiological assays.

    We recognize the importance of minor differences, such as those between Exendin-4 and Exendin-3. Our team invests resources to ensure that each variant, whether modified for research or therapeutic application, maintains structural integrity and behaves in expected, reliable ways. When a model calls for a specific modification or labeling—even unusual isotopic tagging or addition of fluorophores—we design the synthesis carefully, not just tacked on afterthoughts.

    This transparency helps end-users avoid the headaches of batch-to-batch variability that sometimes stall research or trigger expensive troubleshooting. You probably know the frustration of one batch accomplishing what was needed, then the next introducing unexpected noise or instability. By focusing on each project’s requirements, we've reduced inconsistent outcomes in both the research and application stages.

    Not All Exendins Are Created Equal: What Sets Ours Apart

    Our Exendins are not just sequences on paper. They come with a lineage—a documented process from raw material to finished product. The difference comes from this depth of expertise, which reflects years of troubleshooting, validation, and feedback from users. Purity isn’t just a number but a consequence of every upstream decision, from the solvent system in the synthesis to the lyophilization method at the finish.

    Some customers approach us after struggling with “off-the-shelf” peptides that performed unpredictably or degraded in storage. We have invested in robust stability studies, both at refrigerated and room temperatures, to guarantee that our Exendins arrive at your door with the declared integrity and remain stable during reasonable storage. There’s no substitute for confidence in the tools you use, especially if your work guides drug development or supports complex in vivo experiments.

    Where others stake everything on price competition or availability alone, we root our offering in trust built over repeated, verified delivery of results. Exendins from our facility don’t come blended, relabeled, or sourced from unknown facilities overseas. All aspects—from solid-phase synthesis to analytical release—happen under one roof with full traceability. This chain of custody proves essential every time a customer faces regulatory questions, grant deadlines, or scale-up demands.

    Putting Specifications in Context

    Let’s talk practically—Exendin peptides require attention not only for their sequence but also for solubility, storage, and downstream compatibility. Not every application is the same. We offer Exendin-4 for routine GLP-1 receptor studies, as well as customized derivatives for imaging, conjugation, or special delivery vehicles. Researchers in pharmacology and endocrinology highlight the sensitivity of their assays to even minor changes, and we listen to those needs with each production cycle.

    Our models include both standard research-grade Exendins, guaranteed at >95% purity by HPLC, and higher grades tested for endotoxin content for preclinical safety studies. Each specification isn't selected at random—it comes directly from conversations with labs who told us what mattered in their hands. For instance, labs focusing on fluorescent tracer studies benefit from our site-specific labeled Exendins, with uniform modification and detailed data sheets showing labeling ratios, not just batch numbers.

    Having collaborated directly with institutes and life sciences companies, we know the pain points: signal loss due to degradation, ambiguous mass spectra, or non-specific binding from hidden contaminants. The clarity we provide—full COAs with LC-MS, HPLC chromatograms, and real traceability—keeps projects on track. Our staff field technical support calls not from scripts but from experience with the process and the product itself.

    How Experience Shapes Our Approach to Quality

    Our approach to making Exendins has changed with years spent troubleshooting customer problems and learning from the real issues that arise in biological manufacturing. An example comes from an early batch selected for a collaborative research project, where we learned that Trifluoroacetic acid (TFA) residue, even in tiny amounts, interfered with downstream cell culture experiments. That feedback prompted an extra purification stage, which we now use in every batch, resulting in cleaner peptide and happier end-users.

    On another project, a pharmaceutical partner required Exendin analogs with rare amino acid substitutions. Our synthetic chemists adapted the process to minimize epimerization—no half-measures or “close enough” substitutions. That attention led to successful scale-up, with results published in a peer-reviewed study that referenced our exact product. These kinds of partnerships make clear that experience at the bench level drives lasting improvements in every batch that leaves our facility.

    We don’t hide behind generic statements about “meeting customer needs.” Every improvement comes from real troubleshooting—like adjusting lyophilization cycles based on storage and shipping feedback. With some distributors, peptides linger in storage until sold, risking loss of performance. We synchronize production to real demand and store under strict conditions, protecting shelf-life and real-world performance, not just numbers on an analytics sheet.

    Applications across Research and Clinical Development

    Our experience covers a spectrum of users. University labs use Exendin-4 and related analogs for basic GLP-1R pathway studies, while biopharma partners develop novel formulations and delivery technologies using our peptides. Some groups require gram-scale quantities for animal studies, and others need milligram precision for dosing in in vitro signaling assays. We have learned to support all scales, tracking lot consistency and making supply chain adjustments that prevent shortages or missed opportunities.

    In the diagnostic field, demand has moved toward labeled Exendins for imaging applications. This requires attention to conjugation chemistry, not just peptide synthesis. We’ve engineered specialized Exendins conjugated to imaging agents—fluorophores, biotin, and even radiolabels—ensuring efficient signal and retention of biological function. That workflow has helped groups publish repeatable, high-sensitivity imaging results and pursue clinical validation with confidence in their raw materials.

    Formulation specialists approach us to solve challenges with peptide solubility or delivery, including nanoparticles and sustained-release matrices. By working directly with formulation chemists, we solve practical issues in the moment: salt forms that avoid aggregation, lyophilization protocols that support fast dissolution, and stability enhancements that let clinical supplies last beyond initial expectations. These advances stem from our daily engagement with both molecules and users—a cycle of feedback, adjustment, and verification.

    Responding to Challenges in Sourcing and Reliability

    The peptide landscape has changed. Shortages, inconsistent batches, and poorly characterized “catalog” products disrupt too many projects. In this context, offering reliable Exendins demands more than a supply contract; it requires a real sense of stewardship over every molecule produced. Our long-term approach includes strategic sourcing of amino acids, utilization of validated suppliers, and investment in in-house infrastructure that avoids risky outsourcing.

    During the recent supply chain challenges, we invested in extra stockpiles of critical reagents, secured forward supply agreements with trusted partners, and prioritized transparency with customers facing grant deadlines or regulatory milestones. In one notable case, a collaborator required an expedited batch of modified Exendin during a period of regional shipping delays. Our onsite production and direct logistics stepped in, rerouting shipments and securing timely delivery without cutting production corners. This kind of hands-on engagement isn’t common in a world built on drop-shipping.

    Long-term traceability also distinguishes our Exendins. We keep data on each batch—raw materials, process conditions, analytical profiles—so that, if a downstream problem emerges, users can trace it back with precision. We’ve seen competitors respond slowly, disclaiming responsibility or hiding behind vague data. We answer inquiries promptly, with details only full manufacturers can provide, not third-party resellers scrambling for upstream info or passing off faults. That accountability brings researchers and businesses back to our products year after year.

    Regulatory and Safety Considerations

    Peptides destined for regulated environments aren’t the same as those used for academic screening. Preparing Exendins for supporting clinical submissions or advanced preclinical models means staying aligned to best practices—not just at the point of synthesis, but at every stage from purification through to packaging and shipment. Our facility is equipped to handle these needs.

    We pay close attention to the requirements of GLP and clinical documentation. Certificates include full documentation, facilitating submissions for grant proposals, animal studies, or human trials. In-stability studies, sterility validation, and complete records for every involved reagent and process form part of the support package delivered with each clinical or high-purity batch.

    Our involvement with regulatory partners includes answering technical queries, preparing customized documents, and even facilitating audits. We maintain a proactive posture, staying ahead of emerging standards and adjusting batch documentation and process validation as guidelines evolve. We view compliance as more than box-ticking—it’s an extension of the trust relationship we maintain with users navigating uncharted or high-stakes territories.

    Supporting the Next Wave of Innovation in Peptide Science

    Our team celebrates seeing Exendins play a foundational role in next-generation therapeutics and diagnostics. That includes contributing materials for research into metabolic disorders, obesity, cardiovascular health, and diabetes management. As the science moves forward, so must our understanding of how Exendins behave in new delivery mechanisms, novel modification patterns, or emerging animal models.

    Start-ups and academic groups often approach us for technical advice beyond the catalog entry. Whether it’s adjusting buffer compositions for in vivo dosing or consulting on linker chemistry to minimize background in multiplex assays, our doors remain open. Our staff includes not just chemists but scientists with bench experience who’ve seen real-world problems and know how to tailor solutions in response.

    Some of the most exciting results have come through collaboration—where end-users bring us challenges, and we bring not just peptides but experience, context, and partnership. Our most successful projects grow from rapid, transparent lines of communication, tackling obstacles as they appear instead of waiting for problems to arise downstream. The solutions may range from technical consulting to rapid batch customization, but always stand on a platform of reliability built in-house, not sourced anonymously.

    Choosing a Peptide Partner Who Manufactures, Not Just Sells

    We believe users deserve more than an order slip and a tracking number. Every batch of Exendins carries a handshake to the future—delivering innovation, reliability, and scientific transparency to labs and developers working at the front edge of medicine. Researchers working under tight deadlines won’t find themselves caught out by back-ordered lots or ambiguous documentation.

    Transparency starts before a purchase ever takes place. Prospective clients receive full analytical data, not just summaries. Questions receive real answers, informed by the people who made the peptide, not a call center several time zones removed. When feedback necessitates a production change, whether larger scale or unique modification, our in-house teams rapidly accommodate, avoiding the errors and slowdowns that come from relaying instructions through intermediaries.

    Every Exendin batch is more than a product. Years of learning, constant dialogue with the scientific community, and hands-on problem-solving stand behind the label. That dedication continues in every interaction, from the supply of a standard Exendin-4 vial to the multi-gram fulfillment for a preclinical pipeline.

    Looking Forward: Why Source Direct from the Manufacturer

    The peptide marketplace remains crowded with options, but few suppliers are true manufacturers. Direct experience with Exendin synthesis and application shaped every refinement and decision made in our production process. This hands-on control enables early identification of potential issues, rapid iteration, and the long-term product development necessary for new scientific advances.

    We invite our partners—current and future—to see the results that come from a manufacturing mindset. Let us help solve your next challenge, not with vague reassurances or generic peptides, but with solutions built on direct engagement, experience, and scientific accountability. The Exendins you order today aren’t just molecules in a vial. They represent years of earned expertise, continuous improvement, and a lasting commitment to making the science work for you, project after project.

    Top