Exendins

    • Product Name: Exendins
    • Alias: GLP-1 receptor agonists
    • Mininmum Order: 1 g
    • Factroy Site: Yudu County, Ganzhou, Jiangxi, China
    • Price Inquiry: sales3@ascent-chem.com
    • Manufacturer: Ascent Petrochem Holdings Co., Limited
    • CONTACT NOW
    Specifications

    HS Code

    544836

    Product Name Exendins
    Category Peptide
    Main Usage Diabetes treatment research
    Origin Lizard venom
    Molecular Formula C184H282N50O60S
    Molecular Weight 4186.6 g/mol
    Mechanism Of Action GLP-1 receptor agonist
    Storage Temperature -20°C
    Solubility Water soluble
    Purity ≥95% (HPLC)
    Form Lyophilized powder
    Cas Number 141758-74-9
    Sequence HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

    As an accredited Exendins factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.

    Packing & Storage
    Packing Exendins are packaged in sterile, amber glass vials containing 1 mg lyophilized powder, labeled with batch number and storage instructions.
    Shipping Exendins are shipped in secure, temperature-controlled packaging—typically on dry ice—to maintain stability and prevent degradation. Each shipment includes safety documentation and complies with all regulatory guidelines for handling bioactive peptides. Delivery is prompt and traceable, ensuring the product’s integrity upon arrival for research or laboratory use.
    Storage Exendins should be stored at -20°C, protected from light and moisture. Solutions are best prepared in sterile, distilled water or buffer, filtered, and aliquoted to avoid repeated freeze-thaw cycles. Reconstituted solutions should be used promptly or stored at -80°C for long-term use. Proper labeling and handling are essential to maintain peptide stability and bioactivity.
    Free Quote

    Competitive Exendins prices that fit your budget—flexible terms and customized quotes for every order.

    For samples, pricing, or more information, please contact us at +8615365186327 or mail to sales3@ascent-chem.com.

    We will respond to you as soon as possible.

    Tel: +8615365186327

    Email: sales3@ascent-chem.com

    Get Free Quote of Ascent Petrochem Holdings Co., Limited

    Flexible payment, competitive price, premium service - Inquire now!

    Certification & Compliance
    Top