|
HS Code |
544836 |
| Product Name | Exendins |
| Category | Peptide |
| Main Usage | Diabetes treatment research |
| Origin | Lizard venom |
| Molecular Formula | C184H282N50O60S |
| Molecular Weight | 4186.6 g/mol |
| Mechanism Of Action | GLP-1 receptor agonist |
| Storage Temperature | -20°C |
| Solubility | Water soluble |
| Purity | ≥95% (HPLC) |
| Form | Lyophilized powder |
| Cas Number | 141758-74-9 |
| Sequence | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
As an accredited Exendins factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.
| Packing | Exendins are packaged in sterile, amber glass vials containing 1 mg lyophilized powder, labeled with batch number and storage instructions. |
| Shipping | Exendins are shipped in secure, temperature-controlled packaging—typically on dry ice—to maintain stability and prevent degradation. Each shipment includes safety documentation and complies with all regulatory guidelines for handling bioactive peptides. Delivery is prompt and traceable, ensuring the product’s integrity upon arrival for research or laboratory use. |
| Storage | Exendins should be stored at -20°C, protected from light and moisture. Solutions are best prepared in sterile, distilled water or buffer, filtered, and aliquoted to avoid repeated freeze-thaw cycles. Reconstituted solutions should be used promptly or stored at -80°C for long-term use. Proper labeling and handling are essential to maintain peptide stability and bioactivity. |
Competitive Exendins prices that fit your budget—flexible terms and customized quotes for every order.
For samples, pricing, or more information, please contact us at +8615365186327 or mail to sales3@ascent-chem.com.
We will respond to you as soon as possible.
Tel: +8615365186327
Email: sales3@ascent-chem.com
Flexible payment, competitive price, premium service - Inquire now!