|
HS Code |
562076 |
| Name | Exenatide Acetate |
| Cas Number | 141732-76-5 |
| Molecular Formula | C184H282N50O60S |
| Molecular Weight | 4186.6 g/mol |
| Appearance | White to off-white powder |
| Purity | ≥98% |
| Storage Temperature | -20°C |
| Solubility | Soluble in water |
| Peptide Sequence | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
| Indication | Type 2 diabetes mellitus |
| Administration Route | Subcutaneous injection |
| Mechanism Of Action | GLP-1 receptor agonist |
| Synonyms | AC2993, Exendin-4 acetate |
| Origin | Synthetic peptide, based on exendin-4 from Gila monster saliva |
| Activity | Increases insulin secretion, decreases glucagon secretion |
As an accredited Exenatide Acetate factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.
| Packing | Exenatide Acetate, 10 mg per vial, supplied in a sterile, lyophilized powder form, sealed in amber glass vial. |
| Shipping | Exenatide Acetate is shipped in compliance with international regulations for pharmaceutical chemicals. It is packaged in sealed vials or containers, stored under refrigerated conditions (2–8°C) to maintain stability. Shipping involves insulated packaging with ice packs or dry ice and expedited delivery to ensure product integrity during transit. |
| Storage | Exenatide Acetate should be stored at -20°C in a tightly sealed container, protected from light and moisture. For short-term use, storage at 2–8°C is acceptable. The chemical must be kept in a dry, well-ventilated area, away from incompatible substances. Upon reconstitution, solutions should be used promptly or stored at 2–8°C for a limited period as specified by manufacturer guidelines. |
Competitive Exenatide Acetate prices that fit your budget—flexible terms and customized quotes for every order.
For samples, pricing, or more information, please contact us at +8615365186327 or mail to sales3@ascent-chem.com.
We will respond to you as soon as possible.
Tel: +8615365186327
Email: sales3@ascent-chem.com
Flexible payment, competitive price, premium service - Inquire now!