Products

Exenatide Acetate

    • Product Name: Exenatide Acetate
    • Alias: BYETTA
    • Einecs: 242-874-3
    • Mininmum Order: 1 g
    • Factroy Site: Yudu County, Ganzhou, Jiangxi, China
    • Price Inquiry: sales3@ascent-chem.com
    • Manufacturer: Ascent Petrochem Holdings Co., Limited
    • CONTACT NOW
    Specifications

    HS Code

    562076

    Name Exenatide Acetate
    Cas Number 141732-76-5
    Molecular Formula C184H282N50O60S
    Molecular Weight 4186.6 g/mol
    Appearance White to off-white powder
    Purity ≥98%
    Storage Temperature -20°C
    Solubility Soluble in water
    Peptide Sequence HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
    Indication Type 2 diabetes mellitus
    Administration Route Subcutaneous injection
    Mechanism Of Action GLP-1 receptor agonist
    Synonyms AC2993, Exendin-4 acetate
    Origin Synthetic peptide, based on exendin-4 from Gila monster saliva
    Activity Increases insulin secretion, decreases glucagon secretion

    As an accredited Exenatide Acetate factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.

    Packing & Storage
    Packing Exenatide Acetate, 10 mg per vial, supplied in a sterile, lyophilized powder form, sealed in amber glass vial.
    Shipping Exenatide Acetate is shipped in compliance with international regulations for pharmaceutical chemicals. It is packaged in sealed vials or containers, stored under refrigerated conditions (2–8°C) to maintain stability. Shipping involves insulated packaging with ice packs or dry ice and expedited delivery to ensure product integrity during transit.
    Storage Exenatide Acetate should be stored at -20°C in a tightly sealed container, protected from light and moisture. For short-term use, storage at 2–8°C is acceptable. The chemical must be kept in a dry, well-ventilated area, away from incompatible substances. Upon reconstitution, solutions should be used promptly or stored at 2–8°C for a limited period as specified by manufacturer guidelines.
    Free Quote

    Competitive Exenatide Acetate prices that fit your budget—flexible terms and customized quotes for every order.

    For samples, pricing, or more information, please contact us at +8615365186327 or mail to sales3@ascent-chem.com.

    We will respond to you as soon as possible.

    Tel: +8615365186327

    Email: sales3@ascent-chem.com

    Get Free Quote of Ascent Petrochem Holdings Co., Limited

    Flexible payment, competitive price, premium service - Inquire now!

    Certification & Compliance
    Top