Products

Exenatide Acetate

    • Product Name: Exenatide Acetate
    • Alias: BYETTA
    • Einecs: 242-874-3
    • Mininmum Order: 1 g
    • Factroy Site: Yudu County, Ganzhou, Jiangxi, China
    • Price Inquiry: admin@ascent-chem.com
    • Manufacturer: Ascent Petrochem Holdings Co., Limited
    • CONTACT NOW
    Specifications
    HS Code 562076
    Name Exenatide Acetate
    Cas Number 141732-76-5
    Molecular Formula C184H282N50O60S
    Molecular Weight 4186.6 g/mol
    Appearance White to off-white powder
    Purity ≥98%
    Storage Temperature -20°C
    Solubility Soluble in water
    Peptide Sequence HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
    Indication Type 2 diabetes mellitus
    Administration Route Subcutaneous injection
    Mechanism Of Action GLP-1 receptor agonist
    Synonyms AC2993, Exendin-4 acetate
    Origin Synthetic peptide, based on exendin-4 from Gila monster saliva
    Activity Increases insulin secretion, decreases glucagon secretion

    As an accredited Exenatide Acetate factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.

    Packing & Storage
    Packing Exenatide Acetate, 10 mg per vial, supplied in a sterile, lyophilized powder form, sealed in amber glass vial.
    Shipping Exenatide Acetate is shipped in compliance with international regulations for pharmaceutical chemicals. It is packaged in sealed vials or containers, stored under refrigerated conditions (2–8°C) to maintain stability. Shipping involves insulated packaging with ice packs or dry ice and expedited delivery to ensure product integrity during transit.
    Storage Exenatide Acetate should be stored at -20°C in a tightly sealed container, protected from light and moisture. For short-term use, storage at 2–8°C is acceptable. The chemical must be kept in a dry, well-ventilated area, away from incompatible substances. Upon reconstitution, solutions should be used promptly or stored at 2–8°C for a limited period as specified by manufacturer guidelines.
    Application of Exenatide Acetate
    Purity 98%: Exenatide Acetate with purity 98% is used in peptide-based diabetes research, where it ensures consistent pharmacological efficacy and reproducible experimental results. Molecular Weight 4186.6 Da: Exenatide Acetate with molecular weight 4186.6 Da is used in therapeutic peptide synthesis, where it facilitates tailored dosing regimens and bioactivity profiling. Stability Temperature 2-8°C: Exenatide Acetate with stability temperature 2-8°C is used in cold chain pharmaceutical logistics, where it maintains structural integrity and potency during transport and storage. Peptide Content 85%: Exenatide Acetate with peptide content 85% is used in controlled drug delivery systems, where it provides high active loading for sustained glucose-lowering effect. Endotoxin Level <0.1 EU/mg: Exenatide Acetate with endotoxin level <0.1 EU/mg is used in injectable formulation development, where it minimizes immunogenic risk and enhances patient safety. Solubility in Water >10 mg/mL: Exenatide Acetate with solubility in water >10 mg/mL is used in aqueous injectable preparations, where it supports rapid dissolution and homogeneous solution preparation. Residual Solvent <0.5%: Exenatide Acetate with residual solvent <0.5% is used in GMP peptide manufacturing, where it meets regulatory requirements and supports product safety. HPLC Purity ≥99%: Exenatide Acetate with HPLC purity ≥99% is used in clinical trial material supply, where it ensures high reliability and reproducibility of therapeutic performance. Melting Point 180-185°C: Exenatide Acetate with melting point 180-185°C is used in peptide crystallization studies, where it allows determination of physical stability and storage conditions. Particle Size <10 μm: Exenatide Acetate with particle size <10 μm is used in microsphere formulation for sustained-release injections, where it ensures uniform dispersion and controlled release kinetics.
    Free Quote

    Competitive Exenatide Acetate prices that fit your budget—flexible terms and customized quotes for every order.

    For samples, pricing, or more information, please contact us at +8615365186327 or mail to admin@ascent-chem.com.

    We will respond to you as soon as possible.

    Tel: +8615365186327

    Email: admin@ascent-chem.com

    Inquiry

    Get Free Quote of Ascent Petrochem Holdings Co., Limited

    Flexible payment, competitive price, premium service - Inquire now!

    Certification & Compliance
    More Introduction

    Exenatide Acetate: Manufacturing Insights and Real-World Differences

    About Exenatide Acetate: Purpose and Core Features

    On our production lines, we see the true shape of Exenatide Acetate every day. This peptide, widely used in managing type 2 diabetes, draws its significance from the way it supports glucose homeostasis. Beyond its molecular formula—C184H282N50O60S and a sequence of 39 amino acids—Exenatide Acetate serves as a practical tool for endocrinologists. It mimics natural GLP-1, a hormone released after meals, and triggers insulin secretion while suppressing glucagon release. People living with diabetes depend on this precise molecular design to achieve a better balance in their daily blood sugar levels.

    Manufacturers like us contribute something different from those just moving product. We attend to issues that often never reach the paperwork on a distributor’s desk. Peptide quality begins with precise assembly. Each batch goes through high-performance liquid chromatography (HPLC) and mass spectrometry—not just for a passing grade, but to spot even tiny deviations from expected purity or sequence. This care isn’t just for regulatory checkmarks. Unwanted byproducts lead to inconsistencies, and in pharmaceuticals, that can mean the difference between a smooth therapy and severe side effects.

    From Sequence to Substance: Manufacturing the Model

    We work with Exenatide Acetate in lyophilized powder form, as the molecule resists liquid stability over long durations. A typical lot meets the 98% purity threshold, but these numbers don’t tell the full story. Our quality checks go beyond basic purity. Residual solvents, moisture content, and counter-ion analysis (mainly acetate) all shape the end characteristics. Our groups have observed that slight variations in peptide folding or aggregation, sometimes invisible to outside labs, affect the reconstitution process and shelf stability.

    Batch consistency matters. The peptide is manufactured under controlled clean-room conditions meeting Good Manufacturing Practice (GMP) requirements. Each stage—resin swelling, Fmoc deprotection, peptide coupling, and cleavage—receives hands-on attention from chemists familiar with peptide quirks. When we've tightened stepwise protocols and extended the process for difficult residues, downstream purification turns out cleaner, reducing time spent on downstream filtration and lyophilization. We share these details because the inside view of manufacturing highlights why users experience different performance from peptide lots originating from manufacturers that take shortcuts.

    Usage Practices: From Vial to Patient

    Healthcare providers and researchers depend on reconstituted Exenatide Acetate for accurate dosing. The peptide comes in sterile vials—usually with 1mg, 5mg, or 10mg of powder—and requires reconstitution with water for injection. Unlike standard tablets, this therapy avoids the digestive tract where enzymes can degrade natural peptides. Each reconstitution cycle reveals the true quality of the lot. Some lyophilized powders dissolve quickly and remain clear, a mark of well-controlled synthesis and drying processes. On occasion, poor batches clump or take longer to dissolve, often traced back to sub-optimal aggregation control during final drying.

    Clinicians rely on consistency when drawing doses for injection. Fine lyophilized powders produce solutions quickly. Impurities, especially residual TFA from synthesis, can cause abnormal odor or discomfort upon injection. Our technical support teams engage directly with customers when they report concerns about solution appearance or stability. Because we control every element of the manufacturing chain from amino acid purchase to finished vial, we can adjust parameters in future runs. A trader or reseller can’t offer that level of technical feedback or product adaptation.

    Distinguishing True Manufacturer Quality vs. Distributed Product

    There’s a gulf between what leaves a sophisticated peptide facility and what arrives when re-packaged by third parties. Buyers seldom see how packaging, handling, and environmental control affect product stability or purity. Peptide chains as complex as Exenatide Acetate risk degradation if vials are left unrefrigerated, or endure temperature swings in transit. Some resellers buy bulk lots, subdivide, and sell under different labels, introducing fresh risks as products are repackaged in non-sterile conditions.

    In our lab, we’ve tested returned vials from these distributed supplies and found higher levels of aggregation, minor sequence degradation, or unidentified peaks on chromatograms. Our facility’s chain-of-custody systems track every aliquot, environmental records verify continuous cold storage, and every vial holds a batch number for exact traceability. This is why those who depend on exact therapeutic activity lean toward original manufacturing sources when possible. They know supply chain shortcuts influence patient experiences and healthcare outcomes.

    Impact of Specifications: A Chemist’s View from the Floor

    Handling daily peptide synthesis brings out the true role of specifications. Exenatide Acetate’s biological activity hinges on a flawlessly synthesized sequence. Breakage at a single peptide bond, or substitution at just one amino acid, can destroy the peptide’s function or trigger immune reactions. Analytical data must show not just nominal purity but high-resolution mapping of the peptide chain. Our teams have resolved production issues by scanning for minor isomer formations using advanced mass spectrometry; a shortcut in this step may save time for large distributors but can leave critical errors unchecked.

    The acetate form isn’t just a naming detail. The counter-ion, if not fully exchanged or purified, influences pH and the solubility profile after reconstitution. When customers report variable solubility, our manufacturing history often reveals a run with incomplete acetate formation or leftover acid content. We treat each feedback signal seriously, modifying process controls accordingly. The cumulative evidence from thousands of peptide runs tells us ingredient tracing and process transparency cut the risk of adverse events for the end users.

    Contrasts with Other Glucagon-Like Peptide-1 Products

    Within the GLP-1 agonist family, Exenatide Acetate sits alongside synthetic peptides such as Liraglutide and Semaglutide. Their sequences differ, altering how long they last in the bloodstream or interact with the GLP-1 receptor. Exenatide, derived from the saliva of the Gila monster, covers a shorter half-life compared to the fatty acid-modified Liraglutide, which persists longer and allows daily dosing. Our facility runs side-by-side production of both—this gives us a direct view into stability and solubility differences. Exenatide requires more attention in storage, and sensitivity to moisture levels runs higher, making it more delicate to handle in humid regions.

    Comparing batch performance, we notice Exenatide Acetate’s reconstitution profile reacts more strongly to minor changes in excipient fractions. Unmodified peptides tend toward instability outside their ideal pH windows. Formulators searching for a stable prefilled syringe version often run into difficulty, which is less pronounced for acylated analogues. This means that for healthcare professionals deciding between options, storage and administration schedules differ greatly alongside molecular structure. We share these distinctions openly because understanding the hands-on differences guides better therapy planning for providers in real clinical settings.

    The Human Side of Manufacturing: Collaboration and Challenges

    Life inside a peptide manufacturing plant means daily teamwork and troubleshooting on the plant floor. High-volume production brings a stream of new challenges—column fouling, impurity profiles varying by raw material lot, the subtleties of lyophilization cycles that can shift a batch’s moisture profile by fractions of a percent. In the past, our group has identified quality drifts by tracing anomalies in amino acid content back to source fluctuations in our supply chain. Staying transparent with clients about these issues, and catching them early, prevents larger problems downstream.

    Direct communication with clinical partners means we learn rapidly from real-world usage. Some research centers require bulk supply at non-standard concentrations, which has pushed us to fine-tune freeze-drying schedules and particle size. We’ve learned not just from scientific literature, but from close observation of how vials look and behave as they’re opened and mixed by hand each day. Small changes—such as a slightly finer powder—create less static on opening, a daily benefit not captured by any specification sheet. These production insights rarely make their way to distributor marketing materials, but they shape clinicians’ experience and, ultimately, patient care.

    Addressing Issues: Solutions Grounded in Experience

    Every chemical manufacturing operation shakes out new lessons as experience grows. Peptide aggregation remains a common stumbling block in lyophilized drugs—not every problem solves easily. Introducing new analytical methods, improvements in solvent purity, and tighter humidity control have moved our batches away from troublesome aggregate formation. We’ve moved to closed-system lyophilizers and improved vacuum validation protocols, which made measurable differences in reconstitution times and clarity. These are practical steps, the fruit of daily observation and problem-solving sessions among senior manufacturing chemists.

    Waste management and production byproduct disposal, often overlooked in marketing blurbs, demand as much focus as product synthesis. Disposal of spent resins and solvents must meet environmental regulations. Our facility developed a system for capturing and recycling acetonitrile, reducing emissions and cost while keeping our process within safety guidelines. This isn’t a marketing footnote—it means the same systems protecting the environment contribute to higher batch reproducibility.

    Looking Ahead: Trends in Peptide Manufacturing

    Production trends in Exenatide Acetate and other peptides point toward even greater scrutiny over supply integrity and chain-of-custody documentation. Quality-conscious pharmaceutical companies request detailed batch records and demand site inspections—requests we readily accommodate. As market interest in GLP-1 agonists increases, manufacturers face opportunities and pressure to keep pace without cutting corners. High demand often lures less experienced operators into the field, which is where quality slippage occurs. Our experience is that maintaining focus on process control and batch-level documentation makes the difference, not just for regulatory approval but for clinician trust.

    Opportunities for improvement keep surfacing. Automation can take over repetitive process steps, freeing up chemists for oversight and creativity. Investments in real-time process analytics continue to reduce batch failure rates. These efforts pay back in smoother production pipelines, fewer surprises, and a better partnership with those using Exenatide Acetate on the front lines of patient care.

    Practical Insights: Recommendations for Users

    For clinicians and researchers sourcing Exenatide Acetate, direct contact with genuine manufacturers ensures clarity around storage conditions, batch identity, and the history of each vial. Traceability means more to us than a paperwork step; it’s our way of flagging and preventing off-spec performance. Users benefit from checking for proper labeling, expiry dates, and clear reconstitution instructions right from the original producer. If any questions emerge around product characteristics or handling, support teams inside our production plant provide faster and more specialized answers than third-party sales lines or warehouse customer service.

    Colleagues on the clinical end sometimes request customization—non-standard vial sizes, or powders formulated for special research needs. As a manufacturer, we translate these needs into adjustments on the process floor. Responding to these specialized needs forms a closed feedback loop between frontline healthcare and production chemists. Distribution channels lacking this relationship rarely deliver on nuanced technical requirements.

    Conclusion: The Manufacturer’s Perspective on Exenatide Acetate

    A production plant’s doors reveal the complex reality shaping Exenatide Acetate’s quality and reliability. Our daily experience shows how factors overlooked by intermediaries make material differences in the hands of end users. Maintaining consistent process controls, investing in analytic technology, and prioritizing full traceability define true manufacturing quality. These efforts reward the patient, researcher, and clinician who trust the vial labeled Exenatide Acetate—reliable, batch after batch, because the chemical producer stands behind every step from raw material to finished dose.

    Top