Products

Crf (Human, Rat) Acetate

    • Product Name: Crf (Human, Rat) Acetate
    • Alias: Corticotropin-Releasing Factor
    • Mininmum Order: 1 g
    • Factroy Site: Yudu County, Ganzhou, Jiangxi, China
    • Price Inquiry: sales3@ascent-chem.com
    • Manufacturer: Ascent Petrochem Holdings Co., Limited
    • CONTACT NOW
    Specifications

    HS Code

    240197

    Name Crf (Human, Rat) Acetate
    Synonyms Corticotropin-Releasing Factor (CRF), Corticoliberin
    Cas Number 86784-80-7
    Sequence SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
    Molecular Formula C203H317N55O60S
    Molecular Weight 4758.2 g/mol
    Purity ≥95% (HPLC)
    Form Lyophilized powder
    Source Synthetic (human and rat sequence)
    Storage Temperature -20°C
    Solubility Soluble in water or aqueous buffers
    Peptide Classification Neuropeptide hormone
    Application Research use, neuroendocrinology studies
    Appearance White to off-white solid
    Unii 016LQQ2084

    As an accredited Crf (Human, Rat) Acetate factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.

    Packing & Storage
    Packing The product comes in a sterile, amber glass vial containing 1 mg Crf (Human, Rat) Acetate, sealed for laboratory use.
    Shipping Crf (Human, Rat) Acetate is shipped at room temperature as a lyophilized powder to ensure stability during transit. Upon receipt, it should be stored at -20°C for long-term preservation. The packaging ensures protection from moisture and light, maintaining product integrity throughout the shipping process.
    Storage **Storage Description for Crf (Human, Rat) Acetate:** Store Crf (Human, Rat) Acetate at -20°C, protected from light and moisture. Keep the lyophilized powder tightly sealed in its original vial until ready to use. After reconstitution, aliquot and store at -20°C or lower; avoid repeated freeze-thaw cycles for optimal stability. Ensure proper labeling and handle according to safety guidelines for peptides.
    Free Quote

    Competitive Crf (Human, Rat) Acetate prices that fit your budget—flexible terms and customized quotes for every order.

    For samples, pricing, or more information, please contact us at +8615365186327 or mail to sales3@ascent-chem.com.

    We will respond to you as soon as possible.

    Tel: +8615365186327

    Email: sales3@ascent-chem.com

    Get Free Quote of Ascent Petrochem Holdings Co., Limited

    Flexible payment, competitive price, premium service - Inquire now!

    Certification & Compliance
    Top